PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00101926001
Common NameGSBRNA2T00101926001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 332aa    MW: 37499.3 Da    PI: 7.5943
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00101926001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-322882155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprl+Wt+eLH+rF+eav+qLGG++kAtPk ++++m+++gLtl+h+kSHLQkYRl
  GSBRNA2T00101926001 28 KPRLKWTCELHHRFIEAVNQLGGPNKATPKGLMKAMEIPGLTLYHLKSHLQKYRL 82
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-282682IPR009057Homeodomain-like
SuperFamilySSF466892.33E-152782IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-222883IPR006447Myb domain, plants
PfamPF002492.9E-63081IPR001005SANT/Myb domain
PfamPF143791.0E-22129175IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MCLLMESNTT NGNNQKTKMS LVLSTDAKPR LKWTCELHHR FIEAVNQLGG PNKATPKGLM  60
KAMEIPGLTL YHLKSHLQKY RLGKSLKFDD NNLEDSSASE TQEAESKNVS TDFRGSVNVE  120
NNNPANEGVQ ITEALQLQME VQKKLHEQIE VQRHLQVKIE AQGKYLQSVL LKAQHTLAGY  180
TSSTLGMDFA RTELSRLASM VNQSSSFSEL TQVEEYKEEG FLWCKKQENR GTTHPRRSVE  240
SSLTSSESSE TNLNKNNDER MSVELPLMEI KSEKLTEKKK RSLNDVVCME RQPPKKRNLG  300
AYDDDDEHLR LSLNSYKKDM GTCPNIGLGF N*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.266841e-156leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00101926001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893530.0AC189353.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043L15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105513.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X2
TrEMBLA0A078E9580.0A0A078E958_BRANA; BnaA07g28130D protein
TrEMBLM4CJL30.0M4CJL3_BRARP; Uncharacterized protein
STRINGBra004397.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.11e-163G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]